PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca15504.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family LBD
Protein Properties Length: 208aa    MW: 22952.9 Da    PI: 5.1459
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca15504.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260133.58.4e-42281271100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrr+Ca++Cvlapyfp ++p kf ++hk+FGasn++kll++lpe++r da+ss+vyeA+ar+rdPvyG++g i +lq+q++ l+aela+  +
  Dca15504.1  28 PCAACKILRRRCADKCVLAPYFPPTDPLKFSIAHKVFGASNIIKLLQELPESQRADAVSSMVYEANARVRDPVYGSAGAICQLQKQVSDLQAELAKSTA 126
                 7**********************************************************************************************9887 PP

      DUF260 100 e 100
                 +
  Dca15504.1 127 Q 127
                 7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.79427128IPR004883Lateral organ boundaries, LOB
PfamPF031953.3E-4128124IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MIVTPCSPQS PNSPPVSSVA TPPVVMSPCA ACKILRRRCA DKCVLAPYFP PTDPLKFSIA  60
HKVFGASNII KLLQELPESQ RADAVSSMVY EANARVRDPV YGSAGAICQL QKQVSDLQAE  120
LAKSTAQIVT LQSQHSNLLA LFYMQMTSQQ QSSSSTTTTT NNDQQHLHQL MPLYVDDDND  180
DDDNHHTSFL NFYDDHNLNF DSILEPLV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010669677.12e-82PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR01e-67LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A0K9RV849e-85A0A0K9RV84_SPIOL; Uncharacterized protein
STRINGPGSC0003DMT4000194104e-72(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.13e-63LOB domain-containing protein 1